PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00446.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 431aa    MW: 48023.6 Da    PI: 7.0482
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00446.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-3346100155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kprl+Wtp+LHerF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Jcr4S00446.20  46 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 100
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.01443103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-3144101IPR009057Homeodomain-like
SuperFamilySSF466899.32E-1745101IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-2346101IPR006447Myb domain, plants
PfamPF002495.2E-104899IPR001005SANT/Myb domain
PfamPF143798.7E-25147193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MYHHHQHQGK SVHSSSRMPI PPERHLFLQG GNGPGDSGLV LSTDAKPRLK WTPDLHERFI  60
EAVNQLGGAD KATPKTVMKL MGIPGLTLYH LKSHLQKYRL SKNLHGQANS GSSKIGAAAV  120
TSDRMSEANV THMNNLSIGP QTNKSLHISE ALQMQIEVQR RLHEQLEVQR HLQLRIEAQG  180
KYLQAVLEKA QETLGRQNLG TMGLEAAKGL CPQQTQTTPP TDCSVDSCLT SCEGSQKEQE  240
IHNTGMGLRP YNGSALLESK DMAEEHMLHQ TELKWGEDNK MFLSPMGNNA ERRIFSSERS  300
SSDLSMRVGL QGESRNPCSG FSEGRYKERN DDDKFPDQTK KTADSVKLQN ENISPGYRLP  360
YFATKLDLNT HDEIDAASTC KQLDLNGDEA SDSDRTSEQE GDQHDNLLLP RSGQAARKQS  420
IQSKRNKLEQ E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012092686.10.0PREDICTED: uncharacterized protein LOC105650401
RefseqXP_012092687.10.0PREDICTED: uncharacterized protein LOC105650401
TrEMBLA0A067JLA40.0A0A067JLA4_JATCU; Uncharacterized protein
STRINGPOPTR_0013s05670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.41e-136myb-related protein 1